PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr7g005280.1
Common NameMTR_7g005280
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family NAC
Protein Properties Length: 257aa    MW: 28771.2 Da    PI: 9.6179
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr7g005280.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.68.6e-52151391128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeelvv+yLk+kv + +l++ ++i+evd++k++PwdLp      e+e yfFs+++ ky++g+r+nrat+sgyWkatg dk++++
  Medtr7g005280.1  15 LPPGFRFHPTDEELVVQYLKRKVFSFPLPA-SIIPEVDLCKSDPWDLPGD---MEQERYFFSTKEAKYPNGNRSNRATNSGYWKATGLDKQIMN 104
                      79****************************.89***************54...46799***********************************9 PP

              NAM  95 k.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      + ++e+ g+kktLvfy+g+ p+g++tdW+mheyrl
  Medtr7g005280.1 105 SkTHEVAGMKKTLVFYRGKPPHGSRTDWIMHEYRL 139
                      8567779**************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.23E-6011160IPR003441NAC domain
PROSITE profilePS5100558.25215160IPR003441NAC domain
PfamPF023654.2E-2716139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0010089Biological Processxylem development
GO:0010150Biological Processleaf senescence
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MEKMNFVKKN GEVRLPPGFR FHPTDEELVV QYLKRKVFSF PLPASIIPEV DLCKSDPWDL  60
PGDMEQERYF FSTKEAKYPN GNRSNRATNS GYWKATGLDK QIMNSKTHEV AGMKKTLVFY  120
RGKPPHGSRT DWIMHEYRLT SSHSNPPLNE NWVLCRIFLK RRSGAKNGEE RVVKGLKPSS  180
GSNFGDEVKK NSASSSNSSS KVVVFYDFLA EKKNNNTDAS STSITISPAS SGITNELDEQ  240
ENEDSSKSLP SSFGNA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-511216614171NO APICAL MERISTEM PROTEIN
1ut4_B3e-511216614171NO APICAL MERISTEM PROTEIN
1ut7_A3e-511216614171NO APICAL MERISTEM PROTEIN
1ut7_B3e-511216614171NO APICAL MERISTEM PROTEIN
3swm_A3e-511216617174NAC domain-containing protein 19
3swm_B3e-511216617174NAC domain-containing protein 19
3swm_C3e-511216617174NAC domain-containing protein 19
3swm_D3e-511216617174NAC domain-containing protein 19
3swp_A3e-511216617174NAC domain-containing protein 19
3swp_B3e-511216617174NAC domain-containing protein 19
3swp_C3e-511216617174NAC domain-containing protein 19
3swp_D3e-511216617174NAC domain-containing protein 19
4dul_A3e-511216614171NAC domain-containing protein 19
4dul_B3e-511216614171NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.70670.0glandular trichome| leaf| root| stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00507DAPTransfer from AT5G13180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1422690.0BT142269.1 Medicago truncatula clone JCVI-FLMt-5C10 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003620957.10.0NAC transcription factor-like protein
SwissprotQ9FY932e-94NAC83_ARATH; NAC domain-containing protein 83
TrEMBLG7KVL90.0G7KVL9_MEDTR; NAC transcription factor-like protein
STRINGGLYMA18G53954.11e-113(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70434139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.12e-90NAC domain containing protein 83
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]